DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HMX3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001099044.1 Gene:HMX3 / 340784 HGNCID:5019 Length:357 Species:Homo sapiens


Alignment Length:328 Identity:89/328 - (27%)
Similarity:114/328 - (34%) Gaps:79/328 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 AGGYSSNYANATPPSHPHSHPHAHPH--QSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTS 186
            |.|.:|  |...||..|...|...|.  ::|....||.|    .......|...:.||      |
Human     8 AAGTAS--AQPQPPPPPPPAPKESPFSIKNLLNGDHHRP----PPKPQPPPRTLFAPA------S 60

  Fly   187 NGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEP 251
            .......:.|....||:.|:|           |.|...||..........:|...||.......|
Human    61 AAAAAAAAAAAAAKGALEGAA-----------GFALSQVGDLAFPRFEIPAQRFALPAHYLERSP 114

  Fly   252 P-----TNTALGLQELGLKLEKRIEEAVPAGQQL-----QELGMRLRCDDMGSENDDMSEEDRLM 306
            .     |.|                   |||..|     .|..: ||.....|..|..|.|..|.
Human   115 AWWYPYTLT-------------------PAGGHLPRPEASEKAL-LRDSSPASGTDRDSPEPLLK 159

  Fly   307 LDRSPDELGSNDNDD-DLGDSDSDEDL---------------MAETTDGERIIYPWMKKIHVAGV 355
            .|....||.|...|: .|.:|||:|..               .|..|.|..   .|.|     |.
Human   160 ADPDHKELDSKSPDEIILEESDSEESKKEGEAAPGAAGASVGAAAATPGAE---DWKK-----GA 216

  Fly   356 ANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMK 420
            .:...:|....|:.||.::|.|:.:||..|...|||:...|..:|.:|.|:|.|:||||||||.|
Human   217 ESPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNK 281

  Fly   421 WKK 423
            ||:
Human   282 WKR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
HMX3NP_001099044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 14/55 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..229 26/108 (24%)
Homeobox 230..283 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.