DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and OdsH

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:263 Identity:68/263 - (25%)
Similarity:99/263 - (37%) Gaps:74/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MDLPLQCSSTEPPTNTA--LGLQELGLKLEKRIEEAVPAGQQLQ--------ELGMRLRCDDMGS 294
            ||.|....|....||::  ..::::.|..:.|:..|..|.||.|        ||||         
  Fly    51 MDAPNPEISPNSVTNSSSVYMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGM--------- 106

  Fly   295 ENDDMSEEDRLMLDR-SP--------------DELGSNDNDDDLGDSDSDEDLMAETTDGERIIY 344
               |...|.|:.||. ||              |.|.....|.:||.:|..|.             
  Fly   107 ---DPHSEQRIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTES------------- 155

  Fly   345 PWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQ 409
              .||                 :|.||.:...|:.|||:.|..:.|.....|..:|..|.|.|.:
  Fly   156 --SKK-----------------RRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGR 201

  Fly   410 IKIWFQNRRMKWKKD---NKLPNTKNVRKKTVDANGNPTPVAKKPTKRAA--SKKQQQAQQQQQS 469
            |.:||||||.||:|.   .|.|............:|:|.|:::...:..|  ||:.::|..:|..
  Fly   202 IAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQAK 266

  Fly   470 QQQ 472
            :.|
  Fly   267 KLQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.