DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hlx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_009293289.1 Gene:hlx1 / 327096 ZFINID:ZDB-GENE-030131-5304 Length:357 Species:Danio rerio


Alignment Length:445 Identity:92/445 - (20%)
Similarity:145/445 - (32%) Gaps:169/445 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YSSNYANATPPSHPHSHPHAHPHQSLGYYVH--HAPEFISAGAVHSDPTNGYGPAANVPNTSNGG 189
            |:||::..|            .:.|.|:.|.  ..|.|..|..:|      .|.|.|:.      
Zfish    10 YASNFSLWT------------AYCSAGFAVDSMKKPSFCIADILH------VGDAENIQ------ 50

  Fly   190 GGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTN 254
               ||.:::  ..:|..|                   ..||.|.         ||:.|...|...
Zfish    51 ---GSSSLM--AHIGARA-------------------QVHSSGS---------PLRPSPVTPDAR 82

  Fly   255 TALGLQELGLKLEKR--IEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSN 317
            ........|:.|..|  |....|..:.| :.|:                 ||::         |.
Zfish    83 LHPAYLRHGIHLTSRAAINAPPPTSKDL-KFGI-----------------DRIL---------ST 120

  Fly   318 DNDDDLGDSDSDEDLMAETTDGERIIYP-WMKKIHVA--------------------GVANGSYQ 361
            |.:....:|.|..||.:       |:.| ....:||:                    .:.|.:.|
Zfish   121 DFEPKSKESPSLRDLTS-------IVSPNRQSAVHVSASPYFASIDPTMSETSSLMGSIGNAARQ 178

  Fly   362 PGMEP----------------------KRQRT----AYTRHQILELEKEFHYNRYLTRRRRIEIA 400
            .|...                      ||:|:    .::..|...|||.|...:|:|:..|.::|
Zfish   179 SGQHQFQDTFPGRPYAVLSKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLA 243

  Fly   401 HTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQ 465
            ..|.|::.|:|:|||||||||:...:....|:..|             ::|.|.||.      .:
Zfish   244 AMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKEK-------------EQPDKSAAE------TE 289

  Fly   466 QQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGN------PPYIPAAPETTSS 514
            |::....:.:..|..:|.  .|..|...||..|..|      |..:|.:.:.|||
Zfish   290 QKERDDSECETEPSESEF--EDGPEDKSDVDISDLNKASVIIPGPLPVSTQDTSS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/55 (40%)
hlx1XP_009293289.1 Homeobox 212..265 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.