DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXD11

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_067015.2 Gene:HOXD11 / 3237 HGNCID:5134 Length:338 Species:Homo sapiens


Alignment Length:367 Identity:92/367 - (25%)
Similarity:126/367 - (34%) Gaps:126/367 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYG-PAANVPNTSNGGG 190
            ||||.|           ||..|.:.:.:                   ..|| ..|..|  ..|||
Human    47 YSSNLA-----------PHVQPVREVAF-------------------RDYGLERAKWP--YRGGG 79

  Fly   191 GGGSGAVLGGGAVGGSANGYYGGYGG--GYGTANGSVGSTHSQGHSPHSQMMDLPLQ-------- 245
            ||||.   |||:.||...|..||.||  .|..|..:..:..:.......|...||..        
Human    80 GGGSA---GGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAAEEAAMQRELLPPAGRRPDVLF 141

  Fly   246 ------CSSTEPPTN---------TALGLQELGLKLEKRIEEAVP----AGQQLQELGMRLRCDD 291
                  |::..||..         :|:|...:..:...:..||.|    ||.|...         
Human   142 KAPEPVCAAPGPPHGPAGAASNFYSAVGRNGILPQGFDQFYEAAPGPPFAGPQPPP--------- 197

  Fly   292 MGSENDDMSEEDRLMLDRSPDELGSNDNDDD-LGDSDSDEDLMAETTDGERIIYPWMKKIHVAGV 355
                           ....|...|:.|..|. .|..........:.|.|.          ...|.
Human   198 ---------------PPAPPQPEGAADKGDPRTGAGGGGGSPCTKATPGS----------EPKGA 237

  Fly   356 ANGSYQPGMEP------------------KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHT 402
            |.||...|..|                  :::|..||::||.|||:||.:|.|:.:.:|::::..
Human   238 AEGSGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRM 302

  Fly   403 LVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP 444
            |.|::||:||||||||||.||.|        |.:.....|||
Human   303 LNLTDRQVKIWFQNRRMKEKKLN--------RDRLQYFTGNP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 27/51 (53%)
HOXD11NP_067015.2 DUF3528 26..185 CDD:288866 40/172 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..270 19/124 (15%)
Homeobox 269..322 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.