DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXD4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:303 Identity:105/303 - (34%)
Similarity:127/303 - (41%) Gaps:100/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GYYVHHAPEFISAGAVHSD--PTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYG 215
            ||......::...||..:|  |...| |..:......||.|.|.|:.|.....|...    ||.|
Human    27 GYLGEQGADYYGGGAQGADFQPPGLY-PRPDFGEQPFGGSGPGPGSALPARGHGQEP----GGPG 86

  Fly   216 GGYGTANGSVGSTHSQGHSPHSQMMDLP-----LQCSSTEPPTNTALGLQELGLKLEKRIEEAVP 275
            |.|........:..:...:|      ||     .|....:||:.|||                  
Human    87 GHYAAPGEPCPAPPAPPPAP------LPGARAYSQSDPKQPPSGTAL------------------ 127

  Fly   276 AGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGE 340
                                             :.|                             
Human   128 ---------------------------------KQP----------------------------- 130

  Fly   341 RIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVL 405
            .::||||||:||..| |.:|..| ||||.||||||.|:||||||||:||||||||||||||||.|
Human   131 AVVYPWMKKVHVNSV-NPNYTGG-EPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCL 193

  Fly   406 SERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVA 448
            |||||||||||||||||||:||||||.....:..::...:.||
Human   194 SERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 25/106 (24%)
Antp-type hexapeptide 133..138 3/4 (75%)
Homeobox 157..210 CDD:306543 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6194
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40488
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.