DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXD1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:366 Identity:89/366 - (24%)
Similarity:122/366 - (33%) Gaps:151/366 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 PSHPHSHPHAHPHQSL-----GYYVHHAPEFISAGAVHSDPTNGYGPAANVP----NTSNGGGG- 191
            |:.|...|.|.|..:.     .|....||...:.||.:.  ..|.|||.:.|    ..::.||. 
Human    69 PARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYG--FLGSGPAYDFPGVLGRAADDGGSH 131

  Fly   192 ---------GGSGAVLGGGAVGGSANGYYG-----------GYGGGYGTANGSVGSTHSQGHSPH 236
                     .|.|:.|..|.|..:|.|..|           |:.|.:.||:.:.| |:.:..||.
Human   132 VHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPG-TYPKSVSPA 195

  Fly   237 SQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSE 301
            |   .||...|:.|                                                   
Human   196 S---GLPAAFSTFE--------------------------------------------------- 206

  Fly   302 EDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK---------KIHVAGVAN 357
                                                        |||         |:...|.|:
Human   207 --------------------------------------------WMKVKRNASKKGKLAEYGAAS 227

  Fly   358 GSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWK 422
            .|       ...||.::..|:.|||||||:|:||||.||||||:.|.|::.|:||||||||||.|
Human   228 PS-------SAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQK 285

  Fly   423 K---DNKLPNTKNVRKKTVDANG-NPTPVAKKPTKRAASKK 459
            |   :..|.....|....:..:| .||...|.|...:.|::
Human   286 KREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 2/99 (2%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.