DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXC6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:178 Identity:76/178 - (42%)
Similarity:104/178 - (58%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 DMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERI-IYPWMKKIHV-A 353
            |.|| |....|:|.|...|. :.||.|.......|..|::...|.......| |||||::::. :
Human    71 DYGS-NSFYQEKDMLSNCRQ-NTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHS 133

  Fly   354 GVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRR 418
            ||..|:     :.:|.|..|:|:|.||||||||:|||||||||||||:.|.|:||||||||||||
Human   134 GVGYGA-----DRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRR 193

  Fly   419 MKWKKDNKLPNTKNVRKKTVDANGNPT--PVAKKPTKRAASKKQQQAQ 464
            |||||::.|.:|.:      ...|..|  .:..|..||..:::::|.:
Human   194 MKWKKESNLTSTLS------GGGGGATADSLGGKEEKREETEEEKQKE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 41/51 (80%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 4/4 (100%)
Homeobox 145..198 CDD:395001 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.