DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXB9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:238 Identity:72/238 - (30%)
Similarity:106/238 - (44%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 NGSVGSTHSQGHSPHSQMMDLPLQCS----------STEPPTNTALG---------LQELGL-KL 266
            :|...|:...||:.|   ::.| .||          |..|.:..|.|         :|..|: ..
Human    30 SGQYASSRQPGHAEH---LEFP-SCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPA 90

  Fly   267 EKRI----EEAVPAGQQLQELGM-RLRCDD-MGSENDDMSE---EDRLMLDRSPDELGSND---- 318
            |.|.    .|..|.|:.....|. .::.:. :|:..:.:.:   |..|......:.:.||.    
Human    91 ESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGY 155

  Fly   319 NDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEK 383
            .|:.:.:...|::...:|.       |....:|    |..|       :::|..||::|.|||||
Human   156 GDNKICEGSEDKERPDQTN-------PSANWLH----ARSS-------RKKRCPYTKYQTLELEK 202

  Fly   384 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
            ||.:|.||||.||.|:|..|.|||||:||||||||||.||.||
Human   203 EFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 27/145 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 7/43 (16%)
Homeobox 188..241 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.