DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXB6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_011523029.1 Gene:HOXB6 / 3216 HGNCID:5117 Length:288 Species:Homo sapiens


Alignment Length:396 Identity:110/396 - (27%)
Similarity:153/396 - (38%) Gaps:146/396 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SLPHHHSNSAISGHHQ----ASAG----GYS----SNY--ANATPPSHPHSHPHAHPHQSLGYYV 156
            |||   .|:.:|.|.:    .|.|    |::    |:|  .....|:. ...|.|.|.....|:|
Human    10 SLP---ENAQVSRHSRRREPRSTGRQFCGFNAARRSDYKTQQIINPAE-QQRPRAPPLPMSSYFV 70

  Fly   157 HHA-PEFISAG------------AVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSAN 208
            :.. |..:::|            :.::||...| ||...|..              |...|.:.:
Human    71 NSTFPVTLASGQESFLGQLPLYSSGYADPLRHY-PAPYGPGP--------------GQDKGFATS 120

  Fly   209 GYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEA 273
            .||...|||||.|            :|          |              :.|         .
Human   121 SYYPPAGGGYGRA------------AP----------C--------------DYG---------P 140

  Fly   274 VPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTD 338
            .||..:.:|....|...|   |......|.|                  ..|...|:.:..||.:
Human   141 APAFYREKESACALSGAD---EQPPFHPEPR------------------KSDCAQDKSVFGETEE 184

  Fly   339 GE--RIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAH 401
            .:  ..:||||::::...  :.|:.|  ..:|.|..|||:|.|||||||||||||||||||||||
Human   185 QKCSTPVYPWMQRMNSCN--SSSFGP--SGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAH 245

  Fly   402 TLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQ 466
            .|.|:|||||||||||||||||::||                            .|..|..|:::
Human   246 ALCLTERQIKIWFQNRRMKWKKESKL----------------------------LSASQLSAEEE 282

  Fly   467 QQSQQQ 472
            ::.|.:
Human   283 EEKQAE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 44/51 (86%)
HOXB6XP_011523029.1 Homeobox 214..266 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.