DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXB5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:257 Identity:98/257 - (38%)
Similarity:125/257 - (48%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GSGAVLGGGAVGGSANGYYGGYGGGYGTANG--------SVGSTHSQGHSPHSQMMDLPLQ---- 245
            |||:.| .|:....|..:.|.||..|   ||        |..|:|.......|:....|.|    
Human    25 GSGSSL-SGSYRDPAAMHTGSYGYNY---NGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF 85

  Fly   246 ------CSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDR 304
                  ||.:.|.:.........|.|    ...:.|:.|...           .|.:.:.:|.|.
Human    86 RQAASSCSLSSPESLPCTNGDSHGAK----PSASSPSDQATS-----------ASSSANFTEIDE 135

  Fly   305 LMLDRSPDELGSNDNDDDLGDSDSDEDLMAETT---DGER-IIYPWMKKIHVAGVANGSYQPGME 365
            ......|:|..|..:...|..:..:.  ||.:|   :|:. .|:|||:|:|::     ....|.:
Human   136 ASASSEPEEAASQLSSPSLARAQPEP--MATSTAAPEGQTPQIFPWMRKLHIS-----HDMTGPD 193

  Fly   366 PKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            .||.||||||:|.||||||||:||||||||||||||.|.|||||||||||||||||||||||
Human   194 GKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 20/120 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 20/112 (18%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 198..251 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.