DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXB4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:166 Identity:89/166 - (53%)
Similarity:101/166 - (60%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDE 330
            |..|.....|||..|.|.|.  ||:.:.|               ||.......|  .|..|.|  
Human    89 LSPRAPAPPPAGALLPEPGQ--RCEAVSS---------------SPPPPPCAQN--PLHPSPS-- 132

  Fly   331 DLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
                .:...|.::||||:|:||:.| |.:|..| ||||.||||||.|:|||||||||||||||||
Human   133 ----HSACKEPVVYPWMRKVHVSTV-NPNYAGG-EPKRSRTAYTRQQVLELEKEFHYNRYLTRRR 191

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            |:||||.|.||||||||||||||||||||:||||||
Human   192 RVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 17/69 (25%)
Antp-type hexapeptide 141..146 3/4 (75%)
Homeobox 165..218 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6194
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4536
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.