DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dfd and HOXB2

DIOPT Version :9

Sequence 1:	NP_477201.1	Gene:	Dfd / 40832	FlyBaseID:	FBgn0000439	Length:	586	Species:	Drosophila melanogaster
Sequence 2:	NP_002136.1	Gene:	HOXB2 / 3212	HGNCID:	5113	Length:	356	Species:	Homo sapiens

Alignment Length:	109	Identity:	49/109 - (44%)
Similarity:	64/109 - (58%)	Gaps:	26/109 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   344 YPWMKK--------------------IHVAGV---ANGSYQP---GMEPKRQRTAYTRHQILELE 382
            :||||:                    :..:||   |:|...|   |...:|.|||||..|:||||
Human    95 FPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGGGGARRLRTAYTNTQLLELE 159

  Fly   383 KEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
            ||||:|:||.|.||:|||..|.|:|||:|:||||||||.|:..:
Human   160 KEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQ 203

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dfd	NP_477201.1	Homeobox	370..422	CDD:278475	37/51 (73%)
HOXB2	NP_002136.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	39..142		10/46 (22%)
		Antp-type hexapeptide	94..99		2/3 (67%)
		Homeobox	147..199	CDD:278475	37/51 (73%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	197..240		2/7 (29%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000007
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810