DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXA10

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens


Alignment Length:454 Identity:110/454 - (24%)
Similarity:154/454 - (33%) Gaps:147/454 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SGAVGGGAGVGSVGGGGAGGMTGHPHSMHP--ADMVSDYMAHHHNPHS-HSHSHTHSLPHHHSNS 114
            ||....|.|.|..||||.||...|.....|  ||:          |:. .|.....:|....:.:
Human    37 SGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADL----------PYGLQSCGLFPTLGGKRNEA 91

  Fly   115 AISGHHQASAG------GYSSN----YANAT----------PPSHPHSHPHAHPH---------- 149
            |..|......|      ||..:    :.:|.          ||..|...|...|.          
Human    92 ASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATS 156

  Fly   150 --------QSLGYYVHHA----------------------PEFISAGAVHSDPTNGYGPAANVPN 184
                    :...|.::.:                      |:..:.|.....|..||...:....
Human   157 CSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYG 221

  Fly   185 TSNGGGGGGSGA-VLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSS 248
            |:.|.|.||.|| .||.|.......|  .|:......|:||..:...:      :.:|.|     
Human   222 TAKGYGSGGGGAQQLGAGPFPAQPPG--RGFDLPPALASGSADAARKE------RALDSP----- 273

  Fly   249 TEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDE 313
              ||...|.|               ...|.|             |.|....|......|..:|.|
Human   274 --PPPTLACG---------------SGGGSQ-------------GDEEAHASSSAAEELSPAPSE 308

  Fly   314 LG-SNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQ 377
            .. ::...|.||:|..:                        ..||  :......:::|..||:||
Human   309 SSKASPEKDSLGNSKGE------------------------NAAN--WLTAKSGRKKRCPYTKHQ 347

  Fly   378 ILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDAN 441
            .|||||||.:|.||||.||:||:.::.|::||:||||||||||.||.|:   ...:|:.|.:.|
Human   348 TLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNR---ENRIRELTANFN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 11/68 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 35/186 (19%)
Homeobox 339..392 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.