DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXA9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_689952.1 Gene:HOXA9 / 3205 HGNCID:5109 Length:272 Species:Homo sapiens


Alignment Length:338 Identity:89/338 - (26%)
Similarity:119/338 - (35%) Gaps:132/338 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SLPHHHSNSAISGHHQASAGGYSSN-----YANATPPS---HPHSHPHAHPHQSLGYYVHHAPEF 162
            :|..|...|..|...:|:..|.|.|     .|||.|.:   |.|.||:.||         .||  
Human    44 TLAEHPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHP---------QAP-- 97

  Fly   163 ISAGAVHS-------DPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGT 220
            ::|.|...       :||.|....|.:|                                     
Human    98 VAAAAPDGRYMRSWLEPTPGALSFAGLP------------------------------------- 125

  Fly   221 ANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGM 285
                  |:...|..|.      ||.....:.||     |....|.|......:.|..::.|.   
Human   126 ------SSRPYGIKPE------PLSARRGDCPT-----LDTHTLSLTDYACGSPPVDREKQP--- 170

  Fly   286 RLRCDDMGSENDDMSEE--DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK 348
               .:...|||:..:|.  |:..:|  |:...:|                            |  
Human   171 ---SEGAFSENNAENESGGDKPPID--PNNPAAN----------------------------W-- 200

  Fly   349 KIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
             :|....           :::|..||:||.|||||||.:|.||||.||.|:|..|.|:|||:|||
Human   201 -LHARST-----------RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIW 253

  Fly   414 FQNRRMKWKKDNK 426
            |||||||.||.||
Human   254 FQNRRMKMKKINK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
HOXA9NP_689952.1 Hox9_act 1..193 CDD:309661 45/221 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..198 9/50 (18%)
Homeobox 209..262 CDD:306543 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.