DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXA5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:318 Identity:103/318 - (32%)
Similarity:134/318 - (42%) Gaps:81/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANATPPSHPHSHPHAHPHQSLGYYVHH---APEFISAGAVHSDPTNGYGPAANVPNTSNGG 189
            ||.:.|:....:|:.     |...|..|..|   :.:|..:.::||   ..||...|..:.|   
Human     2 SSYFVNSFCGRYPNG-----PDYQLHNYGDHSSVSEQFRDSASMHS---GRYGYGYNGMDLS--- 55

  Fly   190 GGGGSGAVLGGGAVGGSANGYYG-GYGGGYGTANGSVGSTHSQGHSP----HSQMMDLPLQCSST 249
                         ||.|.:|::| |.......|:.|......:...|    ||...| ||.||:.
Human    56 -------------VGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPD-PLPCSAV 106

  Fly   250 EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDEL 314
            .|...:                                  |......:.:|.......|.....:
Human   107 APSPGS----------------------------------DSHHGGKNSLSNSSGASADAGSTHI 137

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGER----------IIYPWMKKIHVAGVANGSYQPGMEPKRQ 369
            .|.:.......::.|....:|....:.          .|||||:|:|::....|    |.|.||.
Human   138 SSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIG----GPEGKRA 198

  Fly   370 RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            ||||||:|.||||||||:||||||||||||||.|.|||||||||||||||||||||||
Human   199 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 17/134 (13%)
Antp-type hexapeptide 176..181 4/4 (100%)
Homeobox 199..251 CDD:306543 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.