DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXA4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:488 Identity:153/488 - (31%)
Similarity:184/488 - (37%) Gaps:183/488 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFLMGYPHAPHHVQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSV 65
            |||||:.              .|.::|||||. ::|..::|           ||...||.     
Human     3 MSSFLIN--------------SNYIEPKFPPF-EEYAQHSG-----------SGGADGGP----- 36

  Fly    66 GGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSN 130
             |||.|      :...||.           |..|.......|||      ..|..:.:|..|:..
Human    37 -GGGPG------YQQPPAP-----------PTQHLPLQQPQLPH------AGGGREPTASYYAPR 77

  Fly   131 YANATPPSHPHS--HPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGG 193
              .|..|::|.:  :| ||......|     |.....||....|.....|.|...          
Human    78 --TAREPAYPAAALYP-AHGAADTAY-----PYGYRGGASPGRPPQPEQPPAQAK---------- 124

  Fly   194 SGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDL--PLQCSSTEPPTNTA 256
                       |.|:|.                      |:.|.....|  |||..:..|..   
Human   125 -----------GPAHGL----------------------HASHVLQPQLPPPLQPRAVPPAA--- 153

  Fly   257 LGLQELGLKLEKRIEEA-----VPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGS 316
                      .:|.|.|     ||||      |....|             ..|:.|:||  ||.
Human   154 ----------PRRCEAAPATPGVPAG------GSAPAC-------------PLLLADKSP--LGL 187

  Fly   317 NDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILEL 381
            ...                    |.::|||||||||:.| |.||..| ||||.||||||.|:|||
Human   188 KGK--------------------EPVVYPWMKKIHVSAV-NPSYNGG-EPKRSRTAYTRQQVLEL 230

  Fly   382 EKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTP 446
            |||||:||||||||||||||||.|||||:||||||||||||||:||||||.....:..|:..|  
Human   231 EKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGP-- 293

  Fly   447 VAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPV 479
                     ..|.|.|:..........| .|||
Human   294 ---------PGKAQTQSPHLHPHPHPST-STPV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 21/98 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 20/122 (16%)
Antp-type hexapeptide 194..199 3/4 (75%)
Homeobox 218..271 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6194
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40488
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.