DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HOXA3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:353 Identity:93/353 - (26%)
Similarity:138/353 - (39%) Gaps:87/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ANGYYGGYGGGYGTANGSVGSTHSQ----------------------------GHSPHSQMMDLP 243
            ::..||||  .|..|||...:.:.|                            ||....::.:..
Human     9 SSAIYGGY--PYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEAC 71

  Fly   244 LQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLD 308
            |:..|..|....:||..    .|.....:|.|...|..:...:.......:.....|        
Human    72 LRTLSAPPSQPPSLGEP----PLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSS-------- 124

  Fly   309 RSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK------KIHVAGVANG------SYQ 361
            .||.:..||:..    .:::.:..:..:....:.|:||||      |...:..::|      ...
Human   125 ASPPQNASNNPT----PANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSP 185

  Fly   362 PGM-EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDN 425
            ||. ..||.|||||..|::|||||||:||||.|.||:|:|:.|.|:||||||||||||||:|||.
Human   186 PGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQ 250

  Fly   426 KLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLE 490
            |       .|..:.::|..:| ::.|....|............|...:.|..|..::        
Human   251 K-------GKGMLTSSGGQSP-SRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSK-------- 299

  Fly   491 SIGDVSSSLGNPPYIPAAPETTSSYPGS 518
               ....:.|.||         :|||.|
Human   300 ---PPQGTYGLPP---------ASYPAS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 38/51 (75%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 13/87 (15%)
Antp-type hexapeptide 155..160 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 8/36 (22%)
Homeobox 195..248 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 19/97 (20%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.