Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006726.1 | Gene: | HOXA2 / 3199 | HGNCID: | 5103 | Length: | 376 | Species: | Homo sapiens |
Alignment Length: | 240 | Identity: | 72/240 - (30%) |
---|---|---|---|
Similarity: | 97/240 - (40%) | Gaps: | 68/240 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 YPWMKKIHVA-----------------------------GVANGSYQPGMEPKRQRTAYTRHQIL 379
Fly 380 ELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGN- 443
Fly 444 --------------PTPVAKKPTKRAASKKQQQAQQQQQS---QQQQTQQTPVMNECIRSDSLES 491
Fly 492 IGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNN 536 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 37/51 (73%) |
HOXA2 | NP_006726.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 42..93 | ||
Antp-type hexapeptide | 94..99 | 3/3 (100%) | |||
Homeobox | 147..200 | CDD:395001 | 37/52 (71%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 198..229 | 3/30 (10%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 257..279 | 6/21 (29%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |