DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and TLX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:300 Identity:76/300 - (25%)
Similarity:102/300 - (34%) Gaps:109/300 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVG 204
            ||:.||   |:.:.:                    |.....:.|.|..||.|      ||.|..|
Human     8 PHNLPH---HEPISF--------------------GIDQILSGPETPGGGLG------LGRGGQG 43

  Fly   205 GSANG-YYGGYGG--GYGTAN-----------GSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNT 255
            ...|| :.|||.|  |||.|.           |..|......|.|      ||:     .||...
Human    44 HGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRP------LPV-----PPPAGG 97

  Fly   256 ALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDND 320
            |               .|||....|...|..........::.....:|||....||         
Human    98 A---------------PAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSP--------- 138

  Fly   321 DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQ--RTAYTRHQILELEK 383
                           .:...||.:|              ||....|||:  ||:::|.|:||||:
Human   139 ---------------FSGTRRIGHP--------------YQNRTPPKRKKPRTSFSRSQVLELER 174

  Fly   384 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            .|...:||....|..:|..|.:::.|:|.||||||.||::
Human   175 RFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
TLX2NP_057254.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 17/70 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 11/53 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..166 10/40 (25%)
Homeobox 160..213 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.