DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and pdx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio


Alignment Length:206 Identity:76/206 - (36%)
Similarity:96/206 - (46%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 AVPAGQQLQELGMRLRCDDMGSEN----DDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLM 333
            |.|.|.|.|.     ...|:.|.|    ||::.....:...|...|.|      ||......||.
Zfish    46 ASPLGAQDQP-----NLTDITSYNMSSRDDLAGPHLHLPQTSQTSLQS------LGGYGDSLDLC 99

  Fly   334 AETTDGER----IIYPWMK--KIHV---AGVANGSYQ-PGMEPKRQRTAYTRHQILELEKEFHYN 388
                 |:|    :.:||||  |.|.   .|...|.|. ...|.||.||||||.|:|||||||.:|
Zfish   100 -----GDRNRYHLPFPWMKSTKSHTHAWKGQWTGPYMVEAEENKRTRTAYTRAQLLELEKEFLFN 159

  Fly   389 RYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKK----------------- 436
            :|::|.||:|:|.||.|:||.||||||||||||||:......:.|..:                 
Zfish   160 KYISRPRRVELALTLSLTERHIKIWFQNRRMKWKKEEDKRRARGVDPEQDSSITSGDLKDESCVG 224

  Fly   437 TVDANGNPTPV 447
            |....|.|:|:
Zfish   225 TATLAGPPSPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.