DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and dlx5a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:439 Identity:88/439 - (20%)
Similarity:128/439 - (29%) Gaps:196/439 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SMHPADMVSDY-MAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHS 142
            |:.|||..:.: ::..|:|...|    .:||  .|.:..||:: :.|||                
Zfish    11 SIKPADFQNPFQLSTMHHPSQES----PTLP--ESTATDSGYY-SPAGG---------------- 52

  Fly   143 HPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNG-YGPAANVPNTSNGGGGGGSGAVLGGGAVGGS 206
                         |||.         :..|.:| ||...|.......|..|.||        ..|
Zfish    53 -------------VHHG---------YCSPNSGTYGKPLNAYQYQYHGVNGSSG--------NYS 87

  Fly   207 ANGY--YGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKR 269
            |..|  ||.|...|....|:.....||                                      
Zfish    88 AKSYPDYGSYSTAYHQYAGTYNRVQSQ-------------------------------------- 114

  Fly   270 IEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMA 334
                                                   .||.|                    .
Zfish   115 ---------------------------------------PSPQE--------------------K 120

  Fly   335 ETTDGE-RIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIE 398
            ||.:.| |::....||:                ::.||.|:..|:..|::.|...:||....|.|
Zfish   121 ETAEPEVRMVNGKPKKV----------------RKPRTIYSSFQLAALQRRFQNTQYLALPERAE 169

  Fly   399 IAHTLVLSERQIKIWFQNRRMKWK---KDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQ 460
            :|.:|.|::.|:||||||:|.|.|   |:.:||             ...:|.:..|  .|.:..|
Zfish   170 LAASLGLTQTQVKIWFQNKRSKLKKIMKNGELP-------------PEHSPSSSDP--MACNSPQ 219

  Fly   461 QQAQQQQQSQQQQTQQTPVMN-------ECIRSDSLESIGDVSSSLGNP 502
            ..|....|..|:...|...:|       |...|....|.|.::|.|..|
Zfish   220 SPAVWDSQGPQRPHHQPQNINTAASTFLESASSSWYSSTGAMNSHLQAP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 32/216 (15%)
Homeobox 140..193 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.