DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb8b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:273 Identity:81/273 - (29%)
Similarity:114/273 - (41%) Gaps:77/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GGSA--NGYY---------GG-----YGGGYGTANGSVGS-----THSQGHSPHSQMMDLPLQCS 247
            ||.:  :.||         ||     ||...|:|......     .|.....||:.....|...:
Zfish    15 GGDSLRSNYYDCPSYTPDLGGRPSVLYGHNTGSAFQHAAQFPDFYHHGTSSFPHASYQQTPCAVA 79

  Fly   248 STEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPD 312
            .....|...||..                |.|.|..        .|:.:.|.::.....|..|  
Zfish    80 YPGDATGNILGQD----------------GLQKQSF--------FGAPDSDFTQFGDCNLKVS-- 118

  Fly   313 ELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQ 377
              |..|      |.:|.|...|:       ::|||:.     .|.|.       :|.|..|:|:|
Zfish   119 --GIRD------DLESAEPCTAQ-------LFPWMRP-----QATGR-------RRGRQTYSRYQ 156

  Fly   378 ILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD---NKLPNTKNVRKKTVD 439
            .|||||||.:|.||||:||||::|.|.|:|||:|||||||||||||:   :|.|::|..:::...
Zfish   157 TLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFPSSKAEQEEIER 221

  Fly   440 ANGNPTPVAKKPT 452
            .....:.|::|.|
Zfish   222 ERQEGSQVSEKHT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 149..201 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.