DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd11a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571242.1 Gene:hoxd11a / 30405 ZFINID:ZDB-GENE-990415-117 Length:276 Species:Danio rerio


Alignment Length:151 Identity:45/151 - (29%)
Similarity:72/151 - (47%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 EEDRLMLDRS-PDELGSNDNDDDLGDSDSD------EDLMAETTDGERIIYPWMKKIHVAGVANG 358
            |:.:...|.| |.:...|.:.|....:..|      |:....|.|.|:                .
Zfish   148 EQSKQKPDTSVPGDAACNPSTDSAEQTKQDPTDTVEEESSVSTCDEEK----------------N 196

  Fly   359 SYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            |.....:.:::|..|:::||.|||:||.:|.|:.:.:|::::..|.|::||:||||||||||.||
Zfish   197 SGSSATKSRKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLSLTDRQVKIWFQNRRMKEKK 261

  Fly   424 DNKLPNTKNVRKKTVDANGNP 444
            .|        |.:.....|||
Zfish   262 LN--------RDRLQYFTGNP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
hoxd11aNP_571242.1 DUF3528 23..158 CDD:288866 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..207 12/74 (16%)
Homeobox 207..260 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.