DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd10a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571241.2 Gene:hoxd10a / 30404 ZFINID:ZDB-GENE-990415-116 Length:332 Species:Danio rerio


Alignment Length:371 Identity:94/371 - (25%)
Similarity:138/371 - (37%) Gaps:131/371 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SHPHSHPHAHPH--QSLGYYVHHAPEFISAGAVHSD---PTNGYGPAANVPNTSNGGGGGGSGAV 197
            |.|:|.|.|:..  .||            .||..:|   .:|.|.|||.                
Zfish     2 SFPNSSPAANTFLVDSL------------IGACRTDFYSSSNMYMPAAT---------------- 38

  Fly   198 LGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQG-----HS-------------------PHSQ 238
                    :..|.||....|...|.|..|..:.|.     ||                   |.:|
Zfish    39 --------AEMGTYGMQTCGLLPALGKRGEVNHQNMDMTVHSYIPQTDTWADPSRSCRLEQPLNQ 95

  Fly   239 M------------------MDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGM 285
            |                  .|...:.||:|.|..::|..:...:...   |..||...:|.:...
Zfish    96 MSTCTFSQSIKEETNCCMYSDKRAKVSSSEIPAYSSLIPESCSVDSP---EIPVPGYFRLSQTYA 157

  Fly   286 RLRCDDMGSENDDMSEEDRLM-LDRSPDELGSN---DNDDDLG-DSDSDEDLMAETTDGERIIYP 345
            ..:..|.  :|:.||....|| |:|:..:..|.   :.:..|. |.|:.....|::.:       
Zfish   158 TAKNPDY--DNETMSPNTTLMQLNRATPKAQSTPFVEVEKKLAHDRDTRSSSPAQSPE------- 213

  Fly   346 WMKKIHVAGVANGS-----------YQPGMEPK---------------RQRTAYTRHQILELEKE 384
              .|:......|.|           ::.|.|.|               ::|..||:||.||||||
Zfish   214 --PKVSTLEEKNCSTEASVSSPELPHREGKESKNDTPTSNWLTAKSGRKKRCPYTKHQTLELEKE 276

  Fly   385 FHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK---DNKL 427
            |.:|.||||.||:||:.::.|::||:||||||||||.||   :|::
Zfish   277 FLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
hoxd10aNP_571241.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..261 10/75 (13%)
COG5576 204..>321 CDD:227863 43/125 (34%)
Homeobox 261..314 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.