DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd9a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571201.3 Gene:hoxd9a / 30350 ZFINID:ZDB-GENE-990415-121 Length:262 Species:Danio rerio


Alignment Length:394 Identity:93/394 - (23%)
Similarity:133/394 - (33%) Gaps:146/394 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YSMTASTGHMSGAVGGGAGV-GSVGGGGAGGMTGHPHSMHPADMV--SDYMAHHHNPHSHSHSHT 104
            |.:....||.:..|.|...: ||           |.....|:.:|  :|:.:....|.|.....:
Zfish    10 YYVDTIMGHEAEDVYGARYIQGS-----------HTAPARPSGVVENADFSSCSFAPKSAVFPAS 63

  Fly   105 HSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHPHAH-PHQSLGYYVHHAPEFISAGAV 168
            .|..|..|.:|:||.:                      ||:.| .|.|...||.   .:|...|.
Zfish    64 WSSVHQPSTAAVSGIY----------------------HPYVHQTHLSDNRYVR---SWIEPVAN 103

  Fly   169 HSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGH 233
            |...|..:      ||:.:.                              ||...|:....::. 
Zfish   104 HISLTGFH------PNSRHS------------------------------GTKTESLPPKRTES- 131

  Fly   234 SPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDD 298
                       ....||.|:.....|..:....:|..||.|.:              |..|..:.
Zfish   132 -----------AAFETETPSVPEFSLNAVSESADKATEERVGS--------------DNSSHGEP 171

  Fly   299 MSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG 363
            ..|:.:..||  |....:|                            |   ||....        
Zfish   172 KDEKQQQQLD--PSNPAAN----------------------------W---IHARST-------- 195

  Fly   364 MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLP 428
               :::|..||::|.|||||||.||.||||.||.|:|..|.|:|||:||||||||||.||.|:..
Zfish   196 ---RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRER 257

  Fly   429 NTKN 432
            ::|:
Zfish   258 SSKD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxd9aNP_571201.3 Hox9_act 1..182 CDD:282473 48/271 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..187 20/143 (14%)
Homeobox 198..251 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.