DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:325 Identity:91/325 - (28%)
Similarity:111/325 - (34%) Gaps:122/325 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ANATPPSHPHSH-----------------PHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPA 179
            |.:.|.|.|.|.                 |.:...|:.||.|...|..:......|.| :||.||
  Rat    21 AYSAPTSFPPSSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFPSSAP-SGYAPA 84

  Fly   180 ANVPNTSNG-------GGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHS 237
            |  .|.|.|       |...|.|......:.|....|....||.      |.|||    |..|..
  Rat    85 A--CNPSYGPSQYYSMGQSEGDGGYFHPSSYGAQLGGLPDSYGA------GGVGS----GPYPPP 137

  Fly   238 QMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEE 302
            |            ||..|.                               :..:..|..|.:|| 
  Rat   138 Q------------PPYGTE-------------------------------QTSNFASAYDLLSE- 158

  Fly   303 DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK---------KIHVAGVANG 358
                             |.:...|.....|.|.|.|       |||         |:...|:.. 
  Rat   159 -----------------DKESSCSSEPSSLTARTFD-------WMKVKRNPPKTAKVSELGLGT- 198

  Fly   359 SYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
                   |...||.:|..|:.|||||||:|:||:|.||:|||.||.|:|.|:||||||||||.||
  Rat   199 -------PGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKK 256

  Fly   424  423
              Rat   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.