DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:546 Identity:128/546 - (23%)
Similarity:162/546 - (29%) Gaps:284/546 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 HHSNSAISGHHQASAGGYSS-----NYANATPPSHPHSHPHAHPH------------QSLGYYVH 157
            ::.|:|     .|..|||||     .:....||..|.   .|..|            ||||....
  Rat     6 YYDNTA-----AALFGGYSSYPGSNGFGYDGPPQPPF---QAATHLEGDYQRSACSLQSLGNAAP 62

  Fly   158 H---------------APEFISA-----------GAVHSDPTNGYGPAA---------------- 180
            |               |||.:.|           .:..|:..||.||:.                
  Rat    63 HAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGASSNSTLTK 127

  Fly   181 -----------------NVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGST 228
                             :.|.|:.|.||||     |||..|||::| .||.|||.|         
  Rat   128 QIFPWMKESRQTSKLKNSSPGTAEGCGGGG-----GGGGGGGSSSG-GGGSGGGGG--------- 177

  Fly   229 HSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMG 293
                                                                             
  Rat   178 ----------------------------------------------------------------- 177

  Fly   294 SENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANG 358
                          |:||                                               
  Rat   178 --------------DKSP----------------------------------------------- 181

  Fly   359 SYQPG-MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWK 422
               || ...||.|||||..|::|||||||:||||.|.||:|:|:.|.||||||||||||||||:|
  Rat   182 ---PGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYK 243

  Fly   423 KDNKLPNTKNVRKKTVDANGNPTPVAK-----------------------KPTKRAASKKQQQAQ 464
            ||.|       .|....::|.|:|...                       .|:..|.||..|.|.
  Rat   244 KDQK-------AKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFSKGHQNAY 301

  Fly   465 QQQQSQQ---------QQTQQTPVMNECIRSDSLESIG---DVSSSLGNPPYI-------PAAPE 510
            ....:.|         |:...||...  ..|..|::.|   ...:..|:|.|:       |..|.
  Rat   302 ALPSNYQPPLKGCGAPQKYPPTPAPE--YESHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPP 364

  Fly   511 TTSSYPGSQQHLSNNNNNGSGNNNNN 536
            ...|..| ..|||   ::.|||.:.|
  Rat   365 AGPSLYG-LNHLS---HHPSGNLDYN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 39/51 (76%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 39/52 (75%)
DUF4074 365..427 CDD:404218 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.