DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxc6a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:185 Identity:76/185 - (41%)
Similarity:100/185 - (54%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 SEEDRLML--DRSPDELGSN----DND---------------DDLGDSDSDEDLMAETTDGER-- 341
            |.:|.::.  .|.|.|.|||    |.|               ..:....:.|...|.|.|.:.  
Zfish    56 SPQDNVVFGSSRGPYEYGSNVFLQDKDVLPSCRQTSMGLNAQSHVAQEYNLEQARAGTQDQKANN 120

  Fly   342 -IIYPWMKKIHV-AGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLV 404
             .|||||::::. :||..||     :.:|.|..|:|:|.||||||||:|||||||||||||:.|.
Zfish   121 IQIYPWMQRMNSHSGVGYGS-----DRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALC 180

  Fly   405 LSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKK 459
            |:|||||||||||||||||:..|.:|    ....::.|.|.. .:|.|:....||
Zfish   181 LTERQIKIWFQNRRMKWKKETNLTST----VPGTESAGTPQE-TEKETEEEPKKK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 41/51 (80%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 4/4 (100%)
Homeobox 146..198 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.