DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb6a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:209 Identity:85/209 - (40%)
Similarity:106/209 - (50%) Gaps:41/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLR------CD----DMGSEN 296
            :||..|....|.....|....|..::   |:|.|:....|..|...|      ||    ....|.
Zfish    25 IPLYSSGYTDPLRHYPGAAYGGSSVQ---EKAYPSSFYQQANGAYSRATAAGPCDYATASFYREK 86

  Fly   297 DDMS-----EEDRLMLD---RSPDELGSNDNDDDLGDS---DSDEDLMAETTDGERIIYPWMKKI 350
            |...     ||...:|.   |..|..||.      |.|   ::||...:..      :||||:::
Zfish    87 DPACALASIEEHSFVLSQDHRKTDCTGST------GKSIYPEADEQKPSAP------VYPWMQRM 139

  Fly   351 HVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQ 415
            :   ..||::  |...:|.|..|||:|.||||||||:||||||||||||||.|.|:|||||||||
Zfish   140 N---SCNGTF--GNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 199

  Fly   416 NRRMKWKKDNKLPN 429
            ||||||||:|||.|
Zfish   200 NRRMKWKKENKLIN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 43/51 (84%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 3/4 (75%)
Homeobox 154..206 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.