DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb4a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:342 Identity:109/342 - (31%)
Similarity:139/342 - (40%) Gaps:123/342 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANAT-PPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPT-------NGYGPAANVPN 184
            :|||.:.. ||...:|       || .|...|:|::.|  |...||:       :.....|:.|.
Zfish     9 NSNYVDPKFPPCEEYS-------QS-DYLPSHSPDYYS--AQRQDPSFQHESIYHQRSGCADPPY 63

  Fly   185 TSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPL----- 244
            :|..|.|..:..:                               ..:||...:..:..||     
Zfish    64 SSCQGPGQPAAVI-------------------------------SPRGHVLPTTALSTPLPEPSH 97

  Fly   245 QCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDR 309
            .|.|..|....|.|              ..|..|....:..|                      :
Zfish    98 HCDSVTPSPPPACG--------------QTPTSQNTSTVSSR----------------------K 126

  Fly   310 SPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYT 374
            .|                              ::||||||:|| .:.:.:|..| ||||.|||||
Zfish   127 DP------------------------------VVYPWMKKVHV-NIVSPNYSGG-EPKRSRTAYT 159

  Fly   375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
            |.|:||||||||||||||||||:||||||.||||||||||||||||||||:|||||| :|..:..
Zfish   160 RQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTK-IRSNSAS 223

  Fly   440 ANGNPTPVAKKPTKRAA 456
            .|.:..|.......||:
Zfish   224 TNSSGCPTLCSNQSRAS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 26/156 (17%)
Antp-type hexapeptide 130..135 3/4 (75%)
Homeobox 154..207 CDD:278475 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6027
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm26182
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4536
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.