DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb2a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:234 Identity:69/234 - (29%)
Similarity:98/234 - (41%) Gaps:79/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKK------------IHVAGVANGS----------------YQPGME----PKRQRTAYTRH 376
            :||||:            ...|..|:.|                .|.|::    .:|.|||||..
Zfish   104 FPWMKEKKSSKKCPKPGATAAAAAASPSQASSGYTTAGLESPTEIQGGLDNVSGSRRLRTAYTNT 168

  Fly   377 QILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK------------------ 423
            |:||||||||:|:||.|.||:|||..|.|:|||:|:||||||||.|:                  
Zfish   169 QLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTTHHRDGQEGEPSGFDL 233

  Fly   424 ----DNKLPNTKNVRKKTVDANGNPTPVAKK--PTKRA---ASKKQQQAQQQQQSQQQQTQQTPV 479
                |...|.:.  :...|..:|:..|...:  ||..|   :|.|.|...::.|:.|.:....| 
Zfish   234 LEGTDASSPYSS--QSLEVSGSGSAAPSESETCPTTAAYTNSSDKSQPTPEEGQASQPEPASVP- 295

  Fly   480 MNECIRSDSLESIGDVSSSLGNPPY-IPAAPETTSSYPG 517
                            .:::.:||| .|.|...|:...|
Zfish   296 ----------------DTAVHSPPYPTPTADNPTTMAEG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100
Antp-type hexapeptide 103..108 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 6/46 (13%)
Homeobox 162..214 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 24/127 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.