DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa2b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:240 Identity:75/240 - (31%)
Similarity:96/240 - (40%) Gaps:80/240 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWM------KKIHVAGVANGS------YQPGMEP----------KRQRTAYTRHQILELEKEFH 386
            ||||      ||......|..:      :.|...|          :|.|||||..|:||||||||
Zfish    89 YPWMKEKKASKKNQTTSTAATTDPGPLYFSPQGSPEISDGGSGATRRLRTAYTNTQLLELEKEFH 153

  Fly   387 YNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK----------DNKLPN------------ 429
            :|:||.|.||:|||..|.|:|||:|:||||||||.|:          |.|.|:            
Zfish   154 FNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENHHGDGKPPSLEEAGGRGDGKS 218

  Fly   430 -----TKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSL 489
                 ..||....::..|.|.              ||.....||||...       |...:|.::
Zfish   219 FFEQVANNVSGALLEREGYPF--------------QQNTLTSQQSQNGH-------NSDSQSATV 262

  Fly   490 ESIGDVSSSL---GNP-PYIPAAPETTSSYPGSQQHLSNNNNNGS 530
            ..:|.....|   .|| |.:|....|.:....|.|      :|||
Zfish   263 SPLGSNDKHLKHFPNPSPTVPICTTTMAPDCASAQ------DNGS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 9/42 (21%)
Antp-type hexapeptide 88..93 3/3 (100%)
Homeobox 137..189 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 6/31 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.