DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Cdx4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:395 Identity:96/395 - (24%)
Similarity:131/395 - (33%) Gaps:162/395 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GGG--AGVGSVGGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGH 119
            |||  ||||:.||.|         |..||   |::.|....||...:.|..::          ..
  Rat    22 GGGSTAGVGTSGGSG---------SPLPA---SNFTAAPVYPHYMGYPHMSNM----------DP 64

  Fly   120 HQASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPN 184
            |..|.|.:||.|   :||....|   .:|..|           .:.|.|..:......||...|:
  Rat    65 HGPSLGAWSSPY---SPPREDWS---TYPGPS-----------STMGTVPMNDMTSSSPAFGSPD 112

  Fly   185 TSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSST 249
            .|..|..||:|....||::..:|:........  ||:.|:...:.|: |||              
  Rat   113 YSTLGPTGGAGGASNGGSLPDAASESLVSIDS--GTSGGATSPSRSR-HSP-------------- 160

  Fly   250 EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDEL 314
                                                                             
  Rat   161 ----------------------------------------------------------------- 160

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKK-IHVAGVANGSYQPGMEPKRQRTAYTRHQI 378
                                         |.||:| :.|.|...       ..::.|..||.||.
  Rat   161 -----------------------------YAWMRKTVQVTGKTR-------TKEKYRVVYTDHQR 189

  Fly   379 LELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNKLPNTKNVRKKTVDAN 441
            ||||||||.|||:|.||:.|:|..|.|||||:||||||||.|.:|  ..|:...:|........:
  Rat   190 LELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDS 254

  Fly   442 GNPTP 446
            |:.:|
  Rat   255 GSISP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
Cdx4NP_001100412.1 Caudal_act 13..166 CDD:398418 52/293 (18%)
Homeobox 181..234 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.