DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_003752231.1 Gene:Hoxa9 / 297099 RGDID:1310001 Length:271 Species:Rattus norvegicus


Alignment Length:400 Identity:101/400 - (25%)
Similarity:132/400 - (33%) Gaps:164/400 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SGAVGG--------GAGVGSVGGGG--AGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSL 107
            :||:|.        ||......|.|  |.|..|.|.....|                       |
  Rat     4 TGALGNYYVDSFLLGADAADELGAGRYAPGALGQPQRQAAA-----------------------L 45

  Fly   108 PHHHSNSAISGHHQASAGGYSSN-----YANATPPS--HPHSHPHAHPHQSLGYYVHHAPEFISA 165
            ..|...|..|...:|:..|.|.|     .|||.|.:  |.|.||:.||         .||  ::|
  Rat    46 AEHPDFSPCSFQSKAAVFGASWNPVHAAGANAVPAAVYHHHHHPYVHP---------QAP--VAA 99

  Fly   166 GAVHS-------DPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANG 223
            .|...       :||.|....|.:|                                        
  Rat   100 AAPDGRYMRSWLEPTPGALSFAGLP---------------------------------------- 124

  Fly   224 SVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLR 288
               |:...|..|.      ||.....:.||     |....|.|......:.|..::.|.      
  Rat   125 ---SSRPYGIKPE------PLSARRGDCPT-----LDTHTLSLTDYACGSPPVDREKQP------ 169

  Fly   289 CDDMGSENDDMSEE--DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIH 351
            .:...|||:..:|.  |:..:|  |:...:|                            |   :|
  Rat   170 SEGAFSENNAENESGGDKPPID--PNNPAAN----------------------------W---LH 201

  Fly   352 VAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQN 416
            ....           :::|..||:||.|||||||.:|.||||.||.|:|..|.|:|||:||||||
  Rat   202 ARST-----------RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQN 255

  Fly   417 RRMKWKKDNK 426
            ||||.||.||
  Rat   256 RRMKMKKINK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
Hoxa9XP_003752231.1 Hox9_act 1..192 CDD:398350 57/283 (20%)
Homeobox 208..262 CDD:395001 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.