DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Nkx1-2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:248 Identity:70/248 - (28%)
Similarity:98/248 - (39%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDEL- 314
            ||...|      .|:.:|.:.| |.||            :|..|.|...|:|       :||.: 
  Rat    37 PPVRLA------ALEAKKSLVE-VEAG------------EDACSGNPIGSQE-------TPDAVG 75

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYP--WM----KKIHVAGVANGSYQPGME-------- 365
            |..|....:..|:::|:..||  |..|...|  |.    ..:....||.|:.:.|.:        
  Rat    76 GGTDPASPVEGSEAEEEEEAE--DAGRAQRPERWQGAHAGSLEAGAVAVGTEESGADGLPASPGS 138

  Fly   366 -----------------PKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
                             |:|.|||:|..|::.||.:|...|||:...|:.:|.:|.|:|.|:|||
  Rat   139 PGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIW 203

  Fly   414 FQNRRMKWKKDN-------------KLPNTKNV-----RKKTVDANGNPTPVA 448
            |||||.||||.|             ..|.|.|.     ...|..:.|.|.|.|
  Rat   204 FQNRRTKWKKQNPGADGAVQAGGSAPQPGTPNAVTGGGGSATGSSPGPPVPGA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.