DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Meox2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:441 Identity:100/441 - (22%)
Similarity:136/441 - (30%) Gaps:211/441 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHS 79
            ::||.:...||.| |...:...|..:.|.|....:...|..:                :.|:|:.
  Rat     9 LRSPHATAQGLHP-FSQSSLALHGRSDHMSYPELSTSSSSCI----------------IAGYPNE 56

  Fly    80 MHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHP 144
                  ...:.:.||..|.|.|.|.|   |||...    .|||    ..||:             
  Rat    57 ------EGMFASQHHRGHHHHHHHHH---HHHQQQ----QHQA----LQSNW------------- 91

  Fly   145 HAHPHQSLGYYVHHAPEFIS--AGAVHS---------DPTNGYGPAANVPNTSNGGGGGGSGAVL 198
                         |.|:..|  :.|.||         .|..|..|.....|:|:.|....:||  
  Rat    92 -------------HLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGA-- 141

  Fly   199 GGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELG 263
                  ..|.|.||                 .|..||                            
  Rat   142 ------ACAPGDYG-----------------RQALSP---------------------------- 155

  Fly   264 LKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDS 328
            .::|||                                            .||....|   .|||
  Rat   156 AEVEKR--------------------------------------------SGSKRKSD---SSDS 173

  Fly   329 DEDLMAETTDGERIIYPWMKKIHVAGVANGSY--QPGMEPKRQRTAYTRHQILELEKEFHYNRYL 391
            .|                           |:|  :...:|:::|||:|:.||.|||.||.::.||
  Rat   174 QE---------------------------GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYL 211

  Fly   392 TRRRRIEIAHTLVLSERQIKIWFQNRRMKWK-----------KDNKLPNTK 431
            ||.||.|||..|.|:|||:|:||||||||||           ::.:|.|.|
  Rat   212 TRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 49/291 (17%)
Homeobox 190..243 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.