DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxd1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001099354.1 Gene:Hoxd1 / 288151 RGDID:1309179 Length:328 Species:Rattus norvegicus


Alignment Length:461 Identity:100/461 - (21%)
Similarity:148/461 - (32%) Gaps:186/461 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MTASTGHMSGAVGGGAGVGSVGGGGAG------GMTGHPHSMHPADMVSDYMAHHHNPHSHSHSH 103
            |::...::|.|.|||:  |.|||...|      .....|.::.||..:.          |...:.
  Rat     1 MSSYLEYVSCAAGGGS--GGVGGDVLGFAPKFCRADARPVALQPAFPLG----------SGDGAF 53

  Fly   104 THSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISA--- 165
            ...||                  .::.....:||..|...|...|..|     .:||..:..   
  Rat    54 VSCLP------------------LAAARPTPSPPVAPAQPPGPQPAAS-----RYAPCTLEGAYE 95

  Fly   166 -GAVHSDPTN----GYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSA--NGYYGGY-------GG 216
             ||..:....    |.|||.:.|                 ||:|.:|  :|.:..|       .|
  Rat    96 RGAAPASAAEYGFLGSGPAFDFP-----------------GALGRAADDSGPHVHYATSAVFSSG 143

  Fly   217 GYGTANGSVG--------------STHSQGH-SPHSQMMDLPLQCSSTEPPTNTALGLQELGLKL 266
            |....:|.|.              ...:.|| .|...:...|..|.....||:   ||.......
  Rat   144 GSFLLSGQVDFAAFAEPGPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTS---GLPAAHSTF 205

  Fly   267 E-KRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDE 330
            | .:::...|...:|.|.|                                              
  Rat   206 EWMKVKRNAPKKSKLSEYG---------------------------------------------- 224

  Fly   331 DLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
                .|:....|                           ||.::..|:.|||||||:|:||||.|
  Rat   225 ----ATSPSSAI---------------------------RTNFSTKQLTELEKEFHFNKYLTRAR 258

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWKKDNK--------------LPNTKNVRKKTVDANGNPTP 446
            |:|||:.|.|::.|:||||||||||.||..:              ||.::....|:....|:|:.
  Rat   259 RMEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASLQLPGSETSPIKSGRNLGSPSQ 323

  Fly   447 VAKKPT 452
             |::|:
  Rat   324 -AQEPS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 33/51 (65%)
Hoxd1NP_001099354.1 COG5576 <208..325 CDD:227863 46/194 (24%)
Homeobox 233..285 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.