DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ind

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:397 Identity:100/397 - (25%)
Similarity:145/397 - (36%) Gaps:122/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VGSVGGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGG 126
            :||.||...........:|.|:..:..|      |.|:..|:..||.............|.:|..
  Fly    24 LGSPGGSPTAAAAVAAAAMLPSIPMLPY------PASYVGSYLFSLGIQQQQQQQQQQQQHAAAA 82

  Fly   127 YSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGG 191
            .::..|.|....|||                          |.|.|.:.|.|.|.:..:.....|
  Fly    83 AAAAAAAAALQQHPH--------------------------VSSSPGSLYHPYAQLFASKRKSSG 121

  Fly   192 GGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTA 256
                               :..|.|.|.:...|.        :|:||.:          ||.:..
  Fly   122 -------------------FSNYEGCYPSPPLSA--------NPNSQQL----------PPIHNL 149

  Fly   257 LGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDD 321
            .|...:|                    |:.|  .:.||.....|......||.      :|:.|:
  Fly   150 YGSPVVG--------------------GLPL--PEPGSFCTSPSASSSASLDY------TNNFDE 186

  Fly   322 DLGD--------SDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQI 378
            ..|.        |.:...|...::.|...|.|.     :...|:.|       ||.|||:|..|:
  Fly   187 PQGKRFKHESSCSPNSSPLKNHSSGGPVEITPL-----INDYADSS-------KRIRTAFTSTQL 239

  Fly   379 LELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGN 443
            ||||:||.:|.||:|.||||||:.|.|||:|:||||||||:|.||......|.|:   :.::||:
  Fly   240 LELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNL---STNSNGS 301

  Fly   444 P--TPVA 448
            |  :||:
  Fly   302 PQASPVS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439734
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.