DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and NKX2-8

DIOPT Version :10

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_055175.2 Gene:NKX2-8 / 26257 HGNCID:16364 Length:239 Species:Homo sapiens


Alignment Length:137 Identity:41/137 - (29%)
Similarity:59/137 - (43%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 DMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHV-AGVANGSYQ 361
            |:.|:|...|.|...|           ......|..|...|.||..||...:..: ....:.|.:
Human    16 DLPEQDAQHLPRREPE-----------PRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR 69

  Fly   362 PGMEP----------KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQN 416
            |...|          |::|..:::.|.||||:.|...|||:...|.::|..|.|:..|:||||||
Human    70 PSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQN 134

  Fly   417 RRMKWKK 423
            .|.|.|:
Human   135 HRYKLKR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 24/55 (44%)
NKX2-8NP_055175.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87 17/81 (21%)
Homeodomain 85..141 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.