DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Pax6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006234695.1 Gene:Pax6 / 25509 RGDID:3258 Length:436 Species:Rattus norvegicus


Alignment Length:259 Identity:64/259 - (24%)
Similarity:91/259 - (35%) Gaps:88/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQIL 379
            |.|.|.......||||                         |....|...:.:|.||::|:.||.
  Rat   198 GENTNSISSNGEDSDE-------------------------AQMRLQLKRKLQRNRTSFTQEQIE 237

  Fly   380 ELEKEF---HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDAN 441
            .|||||   ||.....|.|   :|..:.|.|.:|::||.|||.||:::.||.|.:.      .|:
  Rat   238 ALEKEFERTHYPDVFARER---LAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR------QAS 293

  Fly   442 GNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSL------- 499
            ..|:.:   |...:.|....|...|        ..|||.:  ..|.|:  :|...::|       
  Rat   294 NTPSHI---PISSSFSTSVYQPIPQ--------PTTPVSS--FTSGSM--LGRTDTALTNTYSAL 343

  Fly   500 ---------GNPPYIPAAPETTSSY--------------------PGSQQHLSNNNNNGSGNNN 534
                     .|.|..|..|..||||                    |..|.|:::.....||..:
  Rat   344 PPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/54 (44%)
Pax6XP_006234695.1 PAX 4..142 CDD:128645
Homeobox 228..281 CDD:395001 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.