DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and phx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_593776.1 Gene:phx1 / 2542405 PomBaseID:SPAC32A11.03c Length:942 Species:Schizosaccharomyces pombe


Alignment Length:345 Identity:71/345 - (20%)
Similarity:125/345 - (36%) Gaps:83/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 GHSPHSQMMDLP-------LQCSSTEPPTNTALGLQELG-LKLEKRIEEAVPAGQQLQELGMRLR 288
            |..|....|.||       || ...:.|||......|.. .|::.:.|:..|.....        
pombe    43 GQFPSDNNMQLPHSTYEQHLQ-GEQQNPTNPNYFPPEFDENKVDWKQEKPKPDAPSF-------- 98

  Fly   289 CDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVA 353
            .|:...:|.:.|:    :.:.||.:.....::.:..:|..:|  :.|.|..|:      .|.:||
pombe    99 ADNNSFDNVNSSK----LTNPSPVQPNIVKSESEPANSKQNE--VVEATSVEK------AKENVA 151

  Fly   354 GVANGSYQPG---MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQ 415
            . .:|:.:.|   ..||.::...|..|:..|.:||..:.......|.:|...|.:.||.:.||||
pombe   152 H-ESGTPESGGSTSAPKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQ 215

  Fly   416 NRRMKWKKDNKLPNTKNVR----KKTVDA--------------NGNPT---------------PV 447
            |||.|.|..::....:..|    ::.:|:              :.:||               .:
pombe   216 NRRAKSKLISRRQEEERQRILREQRELDSLNQKVSQAFAHEVLSTSPTSPYVGGIAANRQYANTL 280

  Fly   448 AKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGN---PPYIPAAP 509
            ..|||::..:...:....|..           |..||....:.....:||:..|   |..:|.:.
pombe   281 LPKPTRKTGNFYMKSGPMQSS-----------MEPCIAESDIPIRQSLSSTYYNSLSPNAVPVSS 334

  Fly   510 E---TTSSYPGSQQHLSNNN 526
            :   :.|||......:|.:|
pombe   335 QRKYSASSYSAIPNAMSVSN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 18/51 (35%)
phx1NP_593776.1 COG5576 116..272 CDD:227863 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.