DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Obox5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_663755.2 Gene:Obox5 / 252829 MGIID:2149035 Length:291 Species:Mus musculus


Alignment Length:219 Identity:45/219 - (20%)
Similarity:94/219 - (42%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SQGHSPHSQMM---DLPLQCSS---TEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLR 288
            ::|.|.|.::.   ::|::..|   .||..|.|..:.:..|         |..|..:|       
Mouse     2 AEGPSLHPKLQVASNIPIEIRSQIPQEPARNLAFQMSQSPL---------VTPGSTMQ------- 50

  Fly   289 CDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVA 353
                    ..:|..:|.:|.:..:  ||:.....:..||.                 ::.| ...
Mouse    51 --------SSLSVPERNLLQQESE--GSSRQSGSMPLSDK-----------------YVNK-QTG 87

  Fly   354 GVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRR 418
            .:|:..:      :::||.||:.|...|:|.|...:|...::.:|:|.::.:::.:|||||:|.|
Mouse    88 PMASRKF------RKERTVYTKEQQRLLQKHFDECQYPNEKKIMELAVSVGVTKMEIKIWFKNNR 146

  Fly   419 MKWKKDNKLPNTKNVRKKTVDANG 442
            .|:::    .|.:|:::...::||
Mouse   147 AKYRR----MNLQNIKQALPESNG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 19/51 (37%)
Obox5NP_663755.2 homeodomain 95..153 CDD:238039 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.