DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Gbx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001258382.1 Gene:Gbx1 / 246149 RGDID:621864 Length:425 Species:Rattus norvegicus


Alignment Length:444 Identity:112/444 - (25%)
Similarity:153/444 - (34%) Gaps:143/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TPPSHP-------HSHPHAH-----PHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSN 187
            :||:.|       .:.|..|     |.:.||                  |.....|..:.|....
  Rat     9 SPPARPLPPYERGSAAPEPHCAEPAPRRYLG------------------PRARSEPCVSAPGARR 55

  Fly   188 GGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTA---NGSVG-----STH--------------- 229
            |.|.....|. ||||.|||     ||.|||.|||   :..:|     |.|               
  Rat    56 GPGSAMQRAA-GGGAPGGS-----GGSGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPL 114

  Fly   230 --SQGHSPHSQMMDLP------------------------------------------------- 243
              .|..:|......||                                                 
  Rat   115 VLPQALAPAPLPAGLPPLAPLASFAGRLSNTFCAGLGQAVPSMVALTTALPSFAEPPDAYYGPPE 179

  Fly   244 ------------LQCSSTEPP---TNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMG 293
                        :..|:.|||   |:.||...||....||..|...|............  ..:.
  Rat   180 LAAAAAAAAASTVSRSNPEPPARRTDGALDADELLPAREKVTEPPPPPPPPPPHFSETF--PSLP 242

  Fly   294 SENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIY---PWMKKIHVAG- 354
            :|....|.::..:...:.:..||...::..| .||::..:..:..|...:.   |.:|.....| 
  Rat   243 AEGKVYSSDEEKLEPPAGEPAGSEPEEEGSG-GDSEDSFLDSSAGGPGALLGPKPKLKGSLGTGA 306

  Fly   355 -----VANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 414
                 ||.|...||.:.:|:|||:|..|:||||||||..:||:...|.:|||.|.|||.|:||||
  Rat   307 EEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWF 371

  Fly   415 QNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKP--TKRAASKKQQQAQQQ 466
            ||||.|||:    ....||..::.:...||..|...|  ..|.|.:.|.|..:|
  Rat   372 QNRRAKWKR----IKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQ 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 33/51 (65%)
Gbx1NP_001258382.1 Homeobox 326..379 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.