DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and gbx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_694496.1 Gene:gbx2 / 245948 ZFINID:ZDB-GENE-020509-2 Length:342 Species:Danio rerio


Alignment Length:403 Identity:102/403 - (25%)
Similarity:146/403 - (36%) Gaps:131/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NSAISGHHQASAG-----GYS--SNYANAT--------PPSHPHSH-PHAHPHQSLGYYVHHAPE 161
            :|.|.|..|.|.|     ||.  ..|.:..        ||:.|.|. |..|||.           
Zfish    25 DSLIGGPPQPSPGHFVYTGYPMFMPYRSVVLPPPPPPPPPTLPQSALPTTHPHH----------- 78

  Fly   162 FISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVG 226
                            |...:|::.       ..::..|.|:..:.          ..|..|...
Zfish    79 ----------------PIPGLPSSF-------CSSLAQGMALTSTL----------MATLPGGFS 110

  Fly   227 STHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEK----RIE------------EAVP 275
            |:.||.|...::                 .||.|.:....:|    |::            .::|
Zfish   111 SSPSQQHQDAAR-----------------KLGSQSIHAMFDKSQDIRLDGEDGKTFATKDSTSIP 158

  Fly   276 A---GQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDS--------- 328
            :   .|.:....:|      |...||..|:|    ....||..|.|:|.|....|:         
Zfish   159 SFHDSQSVHTSTVR------GHSKDDSKEDD----CHRKDESFSMDSDLDYSSDDNGPGNAMCQK 213

  Fly   329 -DEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLT 392
             |.|......||          :|....|..:...| :.:|:|||:|..|:||||||||..:||:
Zfish   214 EDGDGSGGLDDG----------VHGGNGAGNTTSTG-KNRRRRTAFTSEQLLELEKEFHCKKYLS 267

  Fly   393 RRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAAS 457
            ...|.:|||.|.|||.|:||||||||.|||:    ....||..||.:.:.||..|...|...:..
Zfish   268 LTERSQIAHALKLSEVQVKIWFQNRRAKWKR----VKAGNVNSKTGEPSRNPKIVVPIPVHVSRF 328

  Fly   458 KKQQQAQQQQQSQ 470
            ..:.|.||.:|::
Zfish   329 AIRSQHQQLEQAR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 33/51 (65%)
gbx2NP_694496.1 Homeobox 244..297 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.