DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc8

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:210 Identity:68/210 - (32%)
Similarity:101/210 - (48%) Gaps:68/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 EAVPA----GQQLQELGMRLRCDDMGSENDDMSE-EDRLMLDRSPDELGSNDNDDDLGDSDSDED 331
            ||:|.    |.| ||..:....|...|.|.:.|| :..|..:.||.                   
  Rat    92 EALPRQSLYGAQ-QEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS------------------- 136

  Fly   332 LMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRR 396
                      :::|||:. |..|..:|           |..|:|:|.|||||||.:|.||||:||
  Rat   137 ----------LMFPWMRP-HAPGRRSG-----------RQTYSRYQTLELEKEFLFNPYLTRKRR 179

  Fly   397 IEIAHTLVLSERQIKIWFQNRRMKWKKDN---KLPNTKNVRKKTVDANGNPTPVAKKPTKRAASK 458
            ||::|.|.|:|||:|||||||||||||:|   |||..::..|  |:..||               
  Rat   180 IEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEK--VEEEGN--------------- 227

  Fly   459 KQQQAQQQQQSQQQQ 473
             :::.:::::.::.:
  Rat   228 -EEEEKEEEEKEENK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.