DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:278 Identity:107/278 - (38%)
Similarity:130/278 - (46%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLP-----------LQCSSTEPPTNTALGL 259
            |.|.|...:...|      .|.|...|...|.|.:..|           ..|:|.:.|.|:    
  Rat    24 SQNSYIPEHSPEY------YGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNS---- 78

  Fly   260 QELGLKLEKRIEEAVPAGQQLQELGMRLRCD--DMGSENDDMSEEDRLMLDRSPDELGSNDNDDD 322
                     |......||....|....| |:  .:...:...|.........:||...|      
  Rat    79 ---------RAHGPAQAGHHHPEKSQPL-CEPAPLSGASASPSPAPPACSQPAPDHPSS------ 127

  Fly   323 LGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHY 387
                         ....:.|:|||||||||:.| |.:|..| ||||.||||||.|:|||||||||
  Rat   128 -------------AASKQPIVYPWMKKIHVSTV-NPNYNGG-EPKRSRTAYTRQQVLELEKEFHY 177

  Fly   388 NRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRK--------KTVDANGNP 444
            ||||||||||||||:|.||||||||||||||||||||::||||| ||.        .|:.|   .
  Rat   178 NRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTK-VRSAPPAGAAPSTLSA---A 238

  Fly   445 TPVAKKPTKRAASKKQQQ 462
            ||...:...::|:..:||
  Rat   239 TPGTSEDHSQSATPPEQQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.