DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and EN2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001418.2 Gene:EN2 / 2020 HGNCID:3343 Length:333 Species:Homo sapiens


Alignment Length:382 Identity:100/382 - (26%)
Similarity:139/382 - (36%) Gaps:112/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SAISGHHQ--ASAGGYSSNYANATP-------------------PSHPHSHPHAHPHQSLGYYVH 157
            :|:.|..|  :|.||.|.....::|                   |.:     |.|||:...:::.
Human    13 AAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGN-----HQHPHRITNFFID 72

  Fly   158 H--APEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGT 220
            :  .|||              |...:......|.|||..|   |.|..||::....||..||...
Human    73 NILRPEF--------------GRRKDAGTCCAGAGGGRGG---GAGGEGGASGAEGGGGAGGSEQ 120

  Fly   221 ANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGM 285
            ..|| ||...:.:.|.:.....||..:.::.|.:...|.:.|.|.                  |.
Human   121 LLGS-GSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLH------------------GG 166

  Fly   286 RLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYP-WM-- 347
            ..:..|.|..           ||.|....|....|..: .||||..........:.:::| |:  
Human   167 AKKGGDPGGP-----------LDGSLKARGLGGGDLSV-SSDSDSSQAGANLGAQPMLWPAWVYC 219

  Fly   348 -----------------KKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
                             ||           .|..|.||.|||:|..|:..|:.||..|||||.:|
Human   220 TRYSDRPSSGPRSRKPKKK-----------NPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQR 273

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANG--NPTPVAKK 450
            |..:|..|.|:|.||||||||:|.|.||.....||..|.   :.|.|  |.:..||:
Human   274 RQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVH---LMAQGLYNHSTTAKE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 29/51 (57%)
EN2NP_001418.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..206 33/144 (23%)
homeobox domain 243..302 33/58 (57%)
Homeobox 247..300 CDD:306543 29/52 (56%)
Engrail_1_C_sig 302..331 CDD:313702 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.