DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and unc-42

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001263845.1 Gene:unc-42 / 192081 WormBaseID:WBGene00006778 Length:279 Species:Caenorhabditis elegans


Alignment Length:245 Identity:54/245 - (22%)
Similarity:91/245 - (37%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 QQLQELGMRLRCDDM----GSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTD 338
            :::::||:.|.  |.    .|..|.:|...|.:.|.|.|........:.||.|.....:...|..
 Worm    20 EKVKDLGVSLH--DFTAYYPSSLDTVSASLRPISDPSSDGAFKKIKTEGLGGSVFGSSIAGVTNT 82

  Fly   339 GERII---YPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIA 400
            ..|:.   .|..::::             ..:|.||.:|:.|:.||:..|..:.|.....|.|:|
 Worm    83 PARLCSLERPESERLN-------------SRRRHRTTFTQEQLQELDAAFQKSHYPDIYVREELA 134

  Fly   401 HTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQ 465
            ....|:|.:|::||||||.|.:|..|..|      |.::.   |......|......:....|..
 Worm   135 RITKLNEARIQVWFQNRRAKHRKHEKQLN------KAINP---PHSFLSNPANTLMRQGMYPAAL 190

  Fly   466 QQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSY 515
            .:.....|:.|.|:                       ||..|:|..::|:
 Worm   191 NRDGFWYQSYQRPM-----------------------PYPTASPSYSNSF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
unc-42NP_001263845.1 Homeobox 103..157 CDD:365835 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.