Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491746.1 | Gene: | ceh-2 / 191615 | WormBaseID: | WBGene00000429 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 50/199 - (25%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 58/199 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 286 RLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETT------------- 337
Fly 338 -------------DGERII----------YPWMKKI------HVAGVANGSY-QPGMEPKRQRTA 372
Fly 373 YTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKT 437
Fly 438 VDAN 441 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 24/51 (47%) |
ceh-2 | NP_491746.1 | Homeobox | 130..182 | CDD:278475 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |