DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ceh-62

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_496326.2 Gene:ceh-62 / 187642 WormBaseID:WBGene00011069 Length:278 Species:Caenorhabditis elegans


Alignment Length:167 Identity:49/167 - (29%)
Similarity:77/167 - (46%) Gaps:19/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
            |..:.:|:||.::..|...||.|:..:.|:.|.:|..:|.:|.|||.|:|.||||||.|.|:|.|
 Worm    92 PNEKSRRKRTTFSPEQATRLEAEYIGDSYMAREKRHLLAQSLKLSENQVKTWFQNRRAKDKRDRK 156

  Fly   427 LPNTKN----------VRKKTVDANGNPTPVAK--KPTKRAASKKQQQAQQ------QQQSQQQQ 473
            ..|..|          .||.:.|:...||...:  .||:...:.....|..      ..:|..|:
 Worm   157 SENASNHTSNSRRSSPSRKSSSDSTPTPTQATQFDMPTQIQTASPPTTADSAIFPPTSPESIIQK 221

  Fly   474 TQQTPVMNECIRSDSLES-IGDVSSSLGNPPYIPAAP 509
            .:|.|........|.|:: :..:|||.....::|:.|
 Worm   222 IEQFPSNQILPNFDILQTYLQSLSSSQIPLQFVPSTP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
ceh-62NP_496326.2 Homeobox 99..152 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.